PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_21808
Common NameKK1_022451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 308aa    MW: 34220.7 Da    PI: 6.3943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_21808genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ ++ +G+g+W++ ++  g+ R++k+c++rw +yl
    C.cajan_21808 14 KGPWTPEEDLKLINHIQIHGPGNWRALPKSAGLERCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.21.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE++++++++  lG++ W++Ia++++ gRt++++k++w+++
    C.cajan_21808  67 RGRFSLEEEDIIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.836961IPR017930Myb domain
SuperFamilySSF466894.12E-3111108IPR009057Homeodomain-like
SMARTSM007171.9E-141363IPR001005SANT/Myb domain
PfamPF002494.7E-161461IPR001005SANT/Myb domain
CDDcd001671.74E-121661No hitNo description
PROSITE profilePS5129426.03462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002498.0E-1667111IPR001005SANT/Myb domain
CDDcd001671.56E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGRVPCCDNN GLKKGPWTPE EDLKLINHIQ IHGPGNWRAL PKSAGLERCG KSCRLRWTNY  60
LRPDIKRGRF SLEEEDIIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDMSSILR SVLGNPSLLN MQGLLGAHVL MNQGFMNLSA TASLLSIKND  180
ENPNLASQNY AQSQGAPPQD LTQFQRPVEG FSGNLSCSSS PPLSSTPDLG ENENLVLQQN  240
QVGLLGNYPA LVHSMNNASQ NMGFDSSSTY VKRGVEEEKD SFCGDLFEFE IPESFDIGDI  300
FCSVPQTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-30911622128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526296.11e-166PREDICTED: transcription factor MYB39-like
TrEMBLA0A151TP660.0A0A151TP66_CAJCA; Transcription factor MYB39
STRINGGLYMA06G45460.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-90MYB-like 102